HPA026761

EPCAM antibody from Atlas Antibodies
17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026761
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026761, RRID:AB_1848198
Product name
Anti-EPCAM
Provider product page
Atlas Antibodies - HPA026761
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSER
VRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR
YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVD
IADVAYY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -