H00004072-B01P

EPCAM antibody from Abnova Corporation
17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1

Antibody data

Product number
H00004072-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004072-B01P, RRID:AB_1579957
Product name
EPCAM purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00004072-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EPCAM protein.
Antigen sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLA
VNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLF
KAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQ
LDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPG
QTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -