HPA026761

EPCAM antibody from Sigma-Aldrich
17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026761, RRID:AB_1848198
Product name
Anti-EPCAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026761
Antibody type
Polyclonal
Antigen
Tumor-associated calcium signal transducer 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSER
VRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR
YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVD
IADVAYY
Storage
-20C
Provider Type Product Number
- No reagents -