HPA000514

ENOX2 antibody from Atlas Antibodies
APK1, COVA1, tNOX
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000514
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000514, RRID:AB_1078558
Product name
Anti-ENOX2
Provider product page
Atlas Antibodies - HPA000514
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEY
KKKEAELEKLKDDKLQVEKMLENLKEKESCASRLC
ASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFL
HVHPFGASIEYICSYLHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -