HPA000514

ENOX2 antibody from Sigma-Aldrich
APK1, COVA1, tNOX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000514
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000514, RRID:AB_1078558
Product name
Anti-ENOX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000514
Antibody type
Polyclonal
Antigen
Tumor-associated hydroquinone oxidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEY
KKKEAELEKLKDDKLQVEKMLENLKEKESCASRLC
ASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFL
HVHPFGASIEYICSYLHR
Storage
-20C
Provider Type Product Number
- No reagents -