Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [5]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90959 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90959, RRID:AB_2665732
- Product name
- Anti-PARP1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENR
YWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKL
YEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAV
KKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM- Epitope
- Binds to an epitope located within the peptide sequence SKLPKPVQDL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2220
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line RT-4
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line HeLa cytoplasmic fractionLane 3: Human cell line HeLa membrane fractionLane 4: Human cell line HeLa nuclear fractionLane 5: Human cell line HeLa chromatin fractionLane 6: Human cell line HeLa cytoskeletal fraction
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from RT-4 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-PARP1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in HeLa cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in A431 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in MCF7 cell line with Anti-PARP1 monoclonal antibody, showing clear cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U2OS cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U251 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular and connective tissue cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.