Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000142-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000142-M01, RRID:AB_464128
- Product name
- PARP1 monoclonal antibody (M01), clone 3G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PARP1.
- Antigen sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRM
AIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVE
VDGFSELRWDDQQKVKKTAEAGGVTGKGQD- Isotype
- IgG
- Antibody clone number
- 3G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references BRCA1, PARP1 and γH2AX in acute myeloid leukemia: Role as biomarkers of response to the PARP inhibitor olaparib.
The ADP-ribosyltransferase PARP10/ARTD10 interacts with proliferating cell nuclear antigen (PCNA) and is required for DNA damage tolerance.
Regulation of FANCD2 by the mTOR pathway contributes to the resistance of cancer cells to DNA double-strand breaks.
PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.
DDB2 promotes chromatin decondensation at UV-induced DNA damage.
The metastasis efficiency modifier ribosomal RNA processing 1 homolog B (RRP1B) is a chromatin-associated factor.
Faraoni I, Compagnone M, Lavorgna S, Angelini DF, Cencioni MT, Piras E, Panetta P, Ottone T, Dolci S, Venditti A, Graziani G, Lo-Coco F
Biochimica et biophysica acta 2015 Mar;1852(3):462-72
Biochimica et biophysica acta 2015 Mar;1852(3):462-72
The ADP-ribosyltransferase PARP10/ARTD10 interacts with proliferating cell nuclear antigen (PCNA) and is required for DNA damage tolerance.
Nicolae CM, Aho ER, Vlahos AH, Choe KN, De S, Karras GI, Moldovan GL
The Journal of biological chemistry 2014 May 9;289(19):13627-37
The Journal of biological chemistry 2014 May 9;289(19):13627-37
Regulation of FANCD2 by the mTOR pathway contributes to the resistance of cancer cells to DNA double-strand breaks.
Shen C, Oswald D, Phelps D, Cam H, Pelloski CE, Pang Q, Houghton PJ
Cancer research 2013 Jun 1;73(11):3393-401
Cancer research 2013 Jun 1;73(11):3393-401
PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.
Pines A, Vrouwe MG, Marteijn JA, Typas D, Luijsterburg MS, Cansoy M, Hensbergen P, Deelder A, de Groot A, Matsumoto S, Sugasawa K, Thoma N, Vermeulen W, Vrieling H, Mullenders L
The Journal of cell biology 2012 Oct 15;199(2):235-49
The Journal of cell biology 2012 Oct 15;199(2):235-49
DDB2 promotes chromatin decondensation at UV-induced DNA damage.
Luijsterburg MS, Lindh M, Acs K, Vrouwe MG, Pines A, van Attikum H, Mullenders LH, Dantuma NP
The Journal of cell biology 2012 Apr 16;197(2):267-81
The Journal of cell biology 2012 Apr 16;197(2):267-81
The metastasis efficiency modifier ribosomal RNA processing 1 homolog B (RRP1B) is a chromatin-associated factor.
Crawford NP, Yang H, Mattaini KR, Hunter KW
The Journal of biological chemistry 2009 Oct 16;284(42):28660-73
The Journal of biological chemistry 2009 Oct 16;284(42):28660-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PARP1 monoclonal antibody (M01), clone 3G4 Western Blot analysis of PARP1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PARP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PARP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol