Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005610-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005610-M02, RRID:AB_714699
- Product name
- EIF2AK2 monoclonal antibody (M02), clone 1D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF2AK2.
- Antigen sequence
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGP
PHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKL
AVEILNKEKKAVSPLLLTTTNSSEGLSMGN- Isotype
- IgG
- Antibody clone number
- 1D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PKR negatively regulates leukemia progression in association with PP2A activation, Bcl-2 inhibition and increased apoptosis.
PKR regulates proliferation, differentiation, and survival of murine hematopoietic stem/progenitor cells.
Increased expression of the dsRNA-activated protein kinase PKR in breast cancer promotes sensitivity to doxorubicin.
Cheng X, Bennett RL, Liu X, Byrne M, Stratford May W
Blood cancer journal 2013 Sep 6;3:e144
Blood cancer journal 2013 Sep 6;3:e144
PKR regulates proliferation, differentiation, and survival of murine hematopoietic stem/progenitor cells.
Liu X, Bennett RL, Cheng X, Byrne M, Reinhard MK, May WS Jr
Blood 2013 Apr 25;121(17):3364-74
Blood 2013 Apr 25;121(17):3364-74
Increased expression of the dsRNA-activated protein kinase PKR in breast cancer promotes sensitivity to doxorubicin.
Bennett RL, Carruthers AL, Hui T, Kerney KR, Liu X, May WS Jr
PloS one 2012;7(9):e46040
PloS one 2012;7(9):e46040
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EIF2AK2 monoclonal antibody (M02), clone 1D11 Western Blot analysis of EIF2AK2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EIF2AK2 expression in transfected 293T cell line by EIF2AK2 monoclonal antibody (M02), clone 1D11.Lane 1: EIF2AK2 transfected lysate(62.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EIF2AK2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EIF2AK2 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EIF2AK2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol