HPA019795

EIF2AK2 antibody from Sigma-Aldrich
EIF2AK1, PKR, PPP1R83, PRKR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019795
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019795, RRID:AB_1848060
Product name
Anti-EIF2AK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019795
Antibody type
Polyclonal
Antigen
Interferon-induced, double-stranded RNA-activated protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPL
LLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQ
LAAKLAYLQILSEETSVKSDYLSSGSFATTCESQS
N
Storage
-20C
Provider Type Product Number
- No reagents -