HPA025967

PLEC antibody from Sigma-Aldrich
EBS1, PCN, PLEC1, PLTN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025967, RRID:AB_10601671
Product name
Anti-PLEC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025967
Antibody type
Polyclonal
Antigen
plectin 1, intermediate filament binding protein 500kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTGLSLLPLSEKAARARQEELYSELQARETFEKTP
VEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQ
FRTGKVTVEKVIKILIT
Storage
-20C
Provider Type Product Number
- No reagents -