H00000578-M01A

BAK1 antibody from Abnova Corporation
BAK, BCL2L7, CDN1

Antibody data

Product number
H00000578-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000578-M01A, RRID:AB_1203997
Product name
BAK1 monoclonal antibody (M01A), clone 1E4
Provider product page
Abnova Corporation - H00000578-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BAK1.
Antigen sequence
LQPTAENAYEYFTKIATSLFESGINWGRVVALLGF
GYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIAR
WIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFV
VRRFFKS
Isotype
IgM
Antibody clone number
1E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -