HPA023501

EIF4EBP1 antibody from Atlas Antibodies
4E-BP1, PHAS-I
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023501
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023501, RRID:AB_1848095
Product name
Anti-EIF4EBP1
Provider product page
Atlas Antibodies - HPA023501
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGV
TSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEM
DI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -