HPA023501

EIF4EBP1 antibody from MilliporeSigma / Merck KGaA
4E-BP1, PHAS-I
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023501
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023501, RRID:AB_1848095
Product name
Anti-EIF4EBP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023501
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4E-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGV
TSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEM
DI
Storage
-20C
Provider Type Product Number
- No reagents -