HPA023501

EIF4EBP1 antibody from Sigma-Aldrich
4E-BP1, PHAS-I
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023501
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023501, RRID:AB_1848095
Product name
Anti-EIF4EBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023501
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4E-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGV
TSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEM
DI
Storage
-20C
Provider Type Product Number
- No reagents -