ABIN503714

FYN antibody from antibodies-online
MGC45350, SLK, SYN

Antibody data

Product number
ABIN503714
Provider
antibodies-online
Product name
anti-FYN Oncogene Related To SRC, FGR, YES (FYN) (N-Term) antibody
Provider product page
antibodies-online - ABIN503714
Antibody type
Polyclonal
Antigen
The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
Host
Rabbit
Antigen sequence
GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP
QHYPS FGVTSIPNYN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -