HPA023887

FYN antibody from Sigma-Aldrich
MGC45350, SLK, SYN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023887, RRID:AB_1849226
Product name
Anti-FYN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023887
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase Fyn recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGT
LRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQ
ILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQ
AEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIR
Storage
-20C
Provider Type Product Number
- No reagents -