HPA000510

TRPC5 antibody from Sigma-Aldrich
PPP1R159
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000510
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000510, RRID:AB_1080391
Product name
Anti-TRPC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000510
Antibody type
Polyclonal
Antigen
Short transient receptor potential channel 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLG
LLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDI
RYSQMEKGKAEACSQSEINLSEVELGEVQGAAQSS
ECPLACSSSLH
Storage
-20C
Provider Type Product Number
- No reagents -