HPA020996

PLAA antibody from Sigma-Aldrich
DOA1, FLJ11281, FLJ12699, PLA2P, PLAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020996
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020996, RRID:AB_1855445
Product name
Anti-PLAA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020996
Antibody type
Polyclonal
Antigen
Phospholipase A-2-activating protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAY
NFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPS
FSDPFTGGGRYVPGSSGSSNTLPTADP
Storage
-20C
Provider Type Product Number
- No reagents -