HPA027367

CRP antibody from Sigma-Aldrich
PTX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027367, RRID:AB_1847216
Product name
Anti-CRP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027367
Antibody type
Polyclonal
Antigen
C-reactive protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLH
FYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGY
SFTVGGS
Storage
-20C
Provider Type Product Number
- No reagents -