Antibody data

Product number
H00000375-M02
Provider
Abnova Corporation
Product name
ARF1 monoclonal antibody (M02), clone 4G6
Provider product page
Abnova Corporation - H00000375-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ARF1.
Antigen sequence
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILY
KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEARE
ELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEIT
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSN
QLRNQK
Isotype
IgG
Antibody clone number
4G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -