HPA001432

HSD17B10 antibody from Atlas Antibodies
17b-HSD10, ABAD, CAMR, ERAB, HADH2, MHBD, MRPP2, MRXS10, SDR5C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001432
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001432, RRID:AB_1078740
Product name
Anti-HSD17B10
Provider product page
Atlas Antibodies - HPA001432
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKF
GRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRV
LDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIIN
TASVAAFEGQVGQA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -