HPA001432

HSD17B10 antibody from Sigma-Aldrich
17b-HSD10, ABAD, CAMR, ERAB, HADH2, MHBD, MRPP2, MRXS10, SDR5C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001432, RRID:AB_1078740
Product name
Anti-HSD17B10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001432
Antibody type
Polyclonal
Antigen
3-Hydroxyacyl-CoA dehydrogenase type-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKF
GRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRV
LDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIIN
TASVAAFEGQVGQA
Storage
-20C
Provider Type Product Number
- No reagents -