HPA024227

STXBP4 antibody from Sigma-Aldrich
MGC50337, Synip
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024227
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024227, RRID:AB_1857630
Product name
Anti-STXBP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024227
Antibody type
Polyclonal
Antigen
Syntaxin-binding protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPLGRNGRSIPATLALESKELVKSVRALLDMDCLP
YGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNL
SRSEENEEDCSRELPNQK
Storage
-20C
Provider Type Product Number
- No reagents -