ABIN970686

FCGR2B antibody from antibodies-online
CD32, CD32B, FCG2, FCGR2

Antibody data

Product number
ABIN970686
Provider
antibodies-online
Product name
anti-Fc Fragment of IgG, Low Affinity IIb, Receptor (CD32) (FCGR2B) (C-Term) antibody
Provider product page
antibodies-online - ABIN970686
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
CREMGETLPEKPANPTNPDEADKVGAENTITYSLL
MHPDA LEEPDDQNRI
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -