HPA000634

IGBP1 antibody from Sigma-Aldrich
IBP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000634, RRID:AB_1079102
Product name
Anti-IGBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000634
Antibody type
Polyclonal
Antigen
Immunoglobulin-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSA
VESGQADDERVREYYLLHLQRWIDISLEEIESIDQ
EIKILRERDSSREASTSNSSRQERPPVKPFILTRN
MAQAKVFGAGYPSLP
Storage
-20C
Provider Type Product Number
- No reagents -