H00000325-A01

APCS antibody from Abnova Corporation
MGC88159, PTX2, SAP
No application information provided.

Antibody data

Product number
H00000325-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000325-A01, RRID:AB_1139182
Product name
APCS polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00000325-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant APCS.
Antigen sequence
MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESV
TDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFS
YNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIE
KFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQ
GYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGD
LYMWDSVLPPENILSAYQGTPLPANILDWQALNYE
IRRYVIIKPLVWV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -