Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN631595 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Catalase (CAT) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Canine
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix.
Makkar RS, Contreras MA, Paintlia AS, Smith BT, Haq E, Singh I
Archives of biochemistry and biophysics 2006 Jul 15;451(2):128-40
Archives of biochemistry and biophysics 2006 Jul 15;451(2):128-40
No comments: Submit comment
No validations: Submit validation data