HPA051282

antibody from Atlas Antibodies

Targeting: CAT

Antibody data

Submit

Validation data

Product number: HPA051282 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA051282, RRID:AB_2681419
Product name: Anti-CAT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVG DKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPE RVVHAKGAGAFGYFE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAT protein structure - HPA051282 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and pancreas tissues using Anti-CAT antibody. Corresponding CAT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, liver, lymph node and pancreas using Anti-CAT antibody HPA051282 (A) shows similar protein distribution across tissues to independent antibody HPA055838 (B).
Antibody #2 product nr: HPA055838
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow using Anti-CAT antibody HPA051282.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CAT antibody HPA051282.
Sample type: HUMAN