SAB1400060

CTSG antibody from Sigma-Aldrich
CG
ELISA
Recommended by provider

Antibody data

Product number
SAB1400060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400060, RRID:AB_1846072
Product name
Anti-CTSG antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400060
Antibody type
Polyclonal
Antigen
CTSG (NP_001902.1, a.a. 1-255) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYM
AYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNI
NVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTI
QNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGT
LCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRI
FGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNV
AHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSF
KLLDQMETPL (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -