Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29899 - Provider product page
- Provider
- Abnova Corporation
- Product name
- KRT15 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial synthetic protein of human KRT15.
- Antigen sequence
RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVE
ESVDGQVVSSHKREI- Isotype
- IgG
- Storage
- Store at 4°C for up to one week. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Hela cell lysate with KRT15 polyclonal antibody (Cat # PAB29899).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of HepG2 cell lysate with KRT15 polyclonal antibody (Cat # PAB29899).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of human fetal brain tissue lysate with KRT15 polyclonal antibody (Cat # PAB29899).