Antibody data

Product number
ABIN184133
Provider
antibodies-online
Product name
anti-Keratin 15 (KRT15) antibody
Provider product page
antibodies-online - ABIN184133
Antibody type
Polyclonal
Antigen
The immunogen for anti-KRT15 antibody: synthetic peptide directed towards the C terminal of human KRT15
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVE
ESVDG QVVSSHKREI
Vial size
50 µg
Provider Type Product Number
- No reagents -