Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405452 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Keratin 16 (KRT16) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
IAATIENAQPILQIDNARLAADDFRTKYEHELALR
QTVEA DVNGLRRVLD- Vial size
- 50 µg
Submitted references Fluorogenic probe triggered by reduction for nucleic acids sensing.
Keratin and filaggrin expression in keratoacanthoma.
Furukawa K, Abe H, Wang J, Oki K, Uda M, Tsuneda S, Ito Y
Nucleic acids symposium series (2004) 2008;(52):353-4
Nucleic acids symposium series (2004) 2008;(52):353-4
Keratin and filaggrin expression in keratoacanthoma.
Ito Y, Kurokawa I, Nishimura K, Hakamada A, Isoda K, Yamanaka K, Tsubura A, Mizutani H
Journal of the European Academy of Dermatology and Venereology : JEADV 2008 Mar;22(3):353-5
Journal of the European Academy of Dermatology and Venereology : JEADV 2008 Mar;22(3):353-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting