Antibody data

Product number
ABIN405452
Provider
antibodies-online
Product name
anti-Keratin 16 (KRT16) antibody
Provider product page
antibodies-online - ABIN405452
Antibody type
Polyclonal
Antigen
The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
Host
Rabbit
Antigen sequence
IAATIENAQPILQIDNARLAADDFRTKYEHELALR
QTVEA DVNGLRRVLD
Vial size
50 µg
Provider Type Product Number
- No reagents -