Antibody data

Product number
ABIN502237
Provider
antibodies-online
Product name
anti-Keratin 16 (KRT16) antibody
Provider product page
antibodies-online - ABIN502237
Antibody type
Polyclonal
Antigen
The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRI
LNEMR DQYEQMAEKN
Vial size
50 µg
Provider Type Product Number
- No reagents -