WH0001030M2

CDKN2B antibody from Sigma-Aldrich
CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
ELISA
Recommended by provider

Antibody data

Product number
WH0001030M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001030M2, RRID:AB_1842801
Product name
Monoclonal Anti-CDKN2B antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001030M2
Antibody type
Monoclonal
Antigen
CDKN2B (AAH14469, a.a. 1-139) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLE
AGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGAR
LDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD*
(without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -