H00001030-M07
antibody from Abnova Corporation
		Targeting: CDKN2B
		
		CDK4I, INK4B, MTS2, P15, p15INK4b, TP15	
	
	
	
	
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001030-M07 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001030-M07, RRID:AB_10721218
- Product name
- CDKN2B monoclonal antibody (M07), clone 8C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CDKN2B.
- Antigen sequence
- MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLE
 AGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA
 EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGAR
 LDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
- Isotype
- IgG
- Antibody clone number
- 8C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of CDKN2B expression in transfected 293T cell line by CDKN2B monoclonal antibody (M07), clone 8C4.Lane 1: CDKN2B transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged CDKN2B is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol