H00139596-B01

UPRT antibody from Abnova Corporation
DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3

Antibody data

Product number
H00139596-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00139596-B01, RRID:AB_1138898
Product name
RP11-311P8.3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00139596-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RP11-311P8.3 protein.
Antigen sequence
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLI
LDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG
GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQ
IGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA
DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKF
EKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ
SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGN
TVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII
QEFPEITILTTEVHPVAPTHFGQKYFGTD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -