HPA021019

TGM2 antibody from Atlas Antibodies
TGC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021019
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021019, RRID:AB_1858247
Product name
Anti-TGM2
Provider product page
Atlas Antibodies - HPA021019
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRR
GQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQE
AGTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -