Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009076-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009076-M02, RRID:AB_10551696
- Product name
- CLDN1 monoclonal antibody (M02), clone 2E2-H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CLDN1.
- Antigen sequence
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSY
AGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSL
LNLSSTLQATRALMVVGILLGVIAIFVATVGMKCM
KCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWY
GNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLC
LLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDY
V- Isotype
- IgG
- Antibody clone number
- 2E2-H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CLDN1 expression in transfected 293T cell line by CLDN1 monoclonal antibody (M02), clone 2E2-H5.Lane 1: CLDN1 transfected lysate (Predicted MW: 22.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CLDN1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Huh7 cells were stained with CLDN1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
- Validation comment
- Immunofluorescence (Circulating Tumor Cell)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of CLDN1 transfected lysate using anti-CLDN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLDN1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol