Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 06-579 - Provider product page

- Provider
- EMD Millipore
- Proper citation
- Millipore Cat#06-579, RRID:AB_11214354
- Product name
- Anti-Gab1 Antibody, CT
- Antibody type
- Polyclonal
- Antigen
- 31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1, (CQKTLALKSTREAWTDGRQSTESETPAKSVK).
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 200 µg
- Storage
- Stable for 1 year at -20ºC from date of receipt. Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
No comments: Submit comment
No validations: Submit validation data