Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007122-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007122-A01, RRID:AB_463497
- Product name
- CLDN5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CLDN5.
- Antigen sequence
MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQ
CKVYDSVLALSTEVQAAR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Claudin-5 is involved in breast cancer cell motility through the N-WASP and ROCK signalling pathways.
Claudin-5 participates in the regulation of endothelial cell motility.
Escudero-Esparza A, Jiang WG, Martin TA
Journal of experimental & clinical cancer research : CR 2012 May 4;31(1):43
Journal of experimental & clinical cancer research : CR 2012 May 4;31(1):43
Claudin-5 participates in the regulation of endothelial cell motility.
Escudero-Esparza A, Jiang WG, Martin TA
Molecular and cellular biochemistry 2012 Mar;362(1-2):71-85
Molecular and cellular biochemistry 2012 Mar;362(1-2):71-85
No comments: Submit comment
No validations: Submit validation data