Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487102 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Claudin 5 (CLDN5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Guinea Pig, Porcine
- Host
- Rabbit
- Antigen sequence
GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYS
APRRP TATGDYDKKN- Epitope
- C-Term
- Isotype
- IgG
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SOX-18 controls endothelial-specific claudin-5 gene expression and barrier function.
Fontijn RD, Volger OL, Fledderus JO, Reijerkerk A, de Vries HE, Horrevoets AJ
American journal of physiology. Heart and circulatory physiology 2008 Feb;294(2):H891-900
American journal of physiology. Heart and circulatory physiology 2008 Feb;294(2):H891-900
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting