Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009075-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009075-M01, RRID:AB_581669
- Product name
- CLDN2 monoclonal antibody (M01), clone 3F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLDN2.
- Antigen sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQ
CDIYSTLLGLPADIQAA- Isotype
- IgG
- Antibody clone number
- 3F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Probing effects of pH change on dynamic response of Claudin-2 mediated adhesion using single molecule force spectroscopy.
Lim TS, Vedula SR, Hui S, Kausalya PJ, Hunziker W, Lim CT
Experimental cell research 2008 Aug 15;314(14):2643-51
Experimental cell research 2008 Aug 15;314(14):2643-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLDN2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol