Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA051548 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA051548, RRID:AB_2681530
- Product name
- Anti-CLDN2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYS
LTGYV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Inactivation of paracellular cation-selective claudin-2 channels attenuates immune-mediated experimental colitis in mice.
Raju P, Shashikanth N, Tsai PY, Pongkorpsakol P, Chanez-Paredes S, Steinhagen PR, Kuo WT, Singh G, Tsukita S, Turner JR
The Journal of clinical investigation 2020 Oct 1;130(10):5197-5208
The Journal of clinical investigation 2020 Oct 1;130(10):5197-5208
No comments: Submit comment
No validations: Submit validation data