H00001364-M02
antibody from Abnova Corporation
Targeting: CLDN4
CPE-R, CPETR, CPETR1, hCPE-R, WBSCR8
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001364-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001364-M02, RRID:AB_1111742
- Product name
- CLDN4 monoclonal antibody (M02), clone 4A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLDN4.
- Antigen sequence
MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQ
CKVYDSLLALPQDLQ- Isotype
- IgG
- Antibody clone number
- 4A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLDN4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CLDN4 transfected lysate using anti-CLDN4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLDN4 MaxPab mouse polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol