PAB19972

MXRA5 antibody from Abnova Corporation
DKFZp564I1922

Antibody data

Product number
PAB19972
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19972, RRID:AB_10965468
Product name
MXRA5 polyclonal antibody
Provider product page
Abnova Corporation - PAB19972
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MXRA5.
Antigen sequence
LRLLHLEGNLLHQLHPSTFSTFTFLDYFRLSTIRH
LYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCD
CEMRWFLEWDAKSRGILKCKKDKAYEGGQLCAMCF
SPKKLYKHEIHKLKDMTCL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -