HPA000508

MXRA5 antibody from Sigma-Aldrich
DKFZp564I1922
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000508, RRID:AB_2147995
Product name
Anti-MXRA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000508
Antibody type
Polyclonal
Antigen
Matrix-remodelling-associated protein 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRLLHLEGNLLHQLHPSTFSTFTFLDYFRLSTIRH
LYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCD
CEMRWFLEWDAKSRGILKCKKDKAYEGGQLCAMCF
SPKKLYKHEIHKLKDMTCL
Storage
-20C
Provider Type Product Number
- No reagents -