H00006258-M02A

RXRG antibody from Abnova Corporation
NR2B3
No application information provided.

Antibody data

Product number
H00006258-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006258-M02A, RRID:AB_1137432
Product name
RXRG monoclonal antibody (M02A), clone 1B2
Provider product page
Abnova Corporation - H00006258-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RXRG.
Antigen sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG
Isotype
IgM
Antibody clone number
1B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -