Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006258-M02A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006258-M02A, RRID:AB_1137432
- Product name
- RXRG monoclonal antibody (M02A), clone 1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RXRG.
- Antigen sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG
- Isotype
- IgM
- Antibody clone number
- 1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data