Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310775 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the C terminal of human MAGEA1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEP
RKLLT QDLVQEKYLE- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of melanoma-associated antigens in oral squamous cell carcinoma.
Ries J, Vairaktaris E, Mollaoglu N, Wiltfang J, Neukam FW, Nkenke E
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2008 Feb;37(2):88-93
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2008 Feb;37(2):88-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting