Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000060-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000060-M01, RRID:AB_425284
- Product name
- ACTB monoclonal antibody (M01), clone 3G4-F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ACTB.
- Antigen sequence
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVSPSIV
GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP
IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL
TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL
SLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAI
LRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR
DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDG
QVITIGNERFRCPEALFQPSFLGMESCGIHETTFN
SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQK
EITALAPSTMKIKIIAPPERRYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCF- Isotype
- IgG
- Antibody clone number
- 3G4-F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Multiple chimeric antigen receptors successfully target chondroitin sulfate proteoglycan 4 in several different cancer histologies and cancer stem cells.
A microRNA-135a/b binding polymorphism in CD133 confers decreased risk and favorable prognosis of lung cancer in Chinese by reducing CD133 expression.
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Identification of early transcripts related to male development in chicken embryos.
Anti-microtubule 'plinabulin' chemical probe KPU-244-B3 labeled both alpha- and beta-tubulin.
7beta-Hydroxy-epiandrosterone-mediated regulation of the prostaglandin synthesis pathway in human peripheral blood monocytes.
Beard RE, Zheng Z, Lagisetty KH, Burns WR, Tran E, Hewitt SM, Abate-Daga D, Rosati SF, Fine HA, Ferrone S, Rosenberg SA, Morgan RA
Journal for immunotherapy of cancer 2014;2:25
Journal for immunotherapy of cancer 2014;2:25
A microRNA-135a/b binding polymorphism in CD133 confers decreased risk and favorable prognosis of lung cancer in Chinese by reducing CD133 expression.
Cheng M, Yang L, Yang R, Yang X, Deng J, Yu B, Huang D, Zhang S, Wang H, Qiu F, Zhou Y, Lu J
Carcinogenesis 2013 Oct;34(10):2292-9
Carcinogenesis 2013 Oct;34(10):2292-9
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Yu Y, Shen H, Yu H, Zhong F, Zhang Y, Zhang C, Zhao J, Li H, Chen J, Liu Y, Yang P
Molecular bioSystems 2011 Jun;7(6):1908-16
Molecular bioSystems 2011 Jun;7(6):1908-16
Identification of early transcripts related to male development in chicken embryos.
Lin YP, Chen LR, Chen CF, Liou JF, Chen YL, Yang JR, Shiue YL
Theriogenology 2010 Oct 15;74(7):1161-1178.e1-8
Theriogenology 2010 Oct 15;74(7):1161-1178.e1-8
Anti-microtubule 'plinabulin' chemical probe KPU-244-B3 labeled both alpha- and beta-tubulin.
Yamazaki Y, Sumikura M, Hidaka K, Yasui H, Kiso Y, Yakushiji F, Hayashi Y
Bioorganic & medicinal chemistry 2010 May 1;18(9):3169-74
Bioorganic & medicinal chemistry 2010 May 1;18(9):3169-74
7beta-Hydroxy-epiandrosterone-mediated regulation of the prostaglandin synthesis pathway in human peripheral blood monocytes.
Le Mée S, Hennebert O, Ferrec C, Wülfert E, Morfin R
Steroids 2008 Oct;73(11):1148-59
Steroids 2008 Oct;73(11):1148-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACTB monoclonal antibody (M01), clone 3G4-F9 Western Blot analysis of ACTB expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ACTB expression in transfected 293T cell line by ACTB monoclonal antibody (M01), clone 3G4-F9.Lane 1: ACTB transfected lysate(42 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACTB monoclonal antibody (M01), clone 3G4-F9. Western Blot analysis of ACTB expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACTB monoclonal antibody (M01), clone S1. Western Blot analysis of ACTB expression in K-562.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACTB is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ACTB on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol