Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182899 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP
- Reactivity
- Human, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILV
LDDTN HERERLEQLF- Vial size
- 0.1 mg
Submitted references Convergent evidence for 2',3'-cyclic nucleotide 3'-phosphodiesterase as a possible susceptibility gene for schizophrenia.
Effects of lower-cost incentives on stimulant abstinence in methadone maintenance treatment: a National Drug Abuse Treatment Clinical Trials Network study.
Peirce TR, Bray NJ, Williams NM, Norton N, Moskvina V, Preece A, Haroutunian V, Buxbaum JD, Owen MJ, O'Donovan MC
Archives of general psychiatry 2006 Jan;63(1):18-24
Archives of general psychiatry 2006 Jan;63(1):18-24
Effects of lower-cost incentives on stimulant abstinence in methadone maintenance treatment: a National Drug Abuse Treatment Clinical Trials Network study.
Peirce JM, Petry NM, Stitzer ML, Blaine J, Kellogg S, Satterfield F, Schwartz M, Krasnansky J, Pencer E, Silva-Vazquez L, Kirby KC, Royer-Malvestuto C, Roll JM, Cohen A, Copersino ML, Kolodner K, Li R
Archives of general psychiatry 2006 Feb;63(2):201-8
Archives of general psychiatry 2006 Feb;63(2):201-8
No comments: Submit comment
No validations: Submit validation data