HPA023338

CNP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023338
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023338, RRID:AB_1847062
Product name
Anti-CNP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023338
Antibody type
Polyclonal
Antigen
2',3'-cyclic-nucleotide 3'-phosphodiesterase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLARVIVDKYRDGTKMVSADAYKITPGARGAFSEE
YKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQL
FEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQW
Storage
-20C
Provider Type Product Number
- No reagents -